-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Collagen VI/COL6A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-235 of human Collagen VI/COL6A1 (P12109) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Collagen VI/COL6A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 37-235 of human Collagen VI/COL6A1 (P12109) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14203A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Collagen VI/COL6A1 |
| Target Synonyms | OPLL; BTHLM1; UCHMD1; Collagen VI/COL6A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Mouse lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 37-235 of human Collagen VI/COL6A1 (P12109). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIQGLTRMPGGRDALKSSVDAVKYFGKGTYTDCAIKKGLEQLLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKHLGVKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEAISQTIDTI | Uniprot ID | P12109 |
Uniprot Id
P12109
Target Species
Human
Target Name
COL6A1
Target Full Name
Collagen alpha-1(VI) chain
Target Function
Collagen VI acts as a cell-binding protein.
Target Involvement
Bethlem myopathy 1 (BTHLM1); Ullrich congenital muscular dystrophy 1 (UCMD1)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Type VI collagen family
Target Synonyms
Alpha 1 (VI) chain (61 AA); CO6A1_HUMAN; COL6A1; COL6A2; COL6A3; collagen 6; Collagen alpha 2(VI) chain; Collagen alpha 3(VI) chain; Collagen alpha-1(VI) chain; collagen six; Collagen type VI alpha 1; Collagen type VI alpha 2; Collagen type VI alpha 3; Collagen VI alpha 1 polypeptide; Collagen VI alpha 2 polypeptide; Collagen VI alpha 3 polypeptide; CollagenVI; Human mRNA for collagen VI alpha 2 C terminal globular domain; OPLL; PP3610
Target Background
The collagens are a superfamily of proteins that play a role in maintaining the integrity of various tissues. Collagens are extracellular matrix proteins and have a triple-helical domain as their common structural element. Collagen VI is a major structural component of microfibrils. The basic structural unit of collagen VI is a heterotrimer of the alpha1(VI), alpha2(VI), and alpha3(VI) chains. The alpha2(VI) and alpha3(VI) chains are encoded by the COL6A2 and COL6A3 genes, respectively. The protein encoded by this gene is the alpha 1 subunit of type VI collagen (alpha1(VI) chain). Mutations in the genes that code for the collagen VI subunits result in the autosomal dominant disorder, Bethlem myopathy.
Notification