-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CORIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CORIN (NP_006578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CORIN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CORIN (NP_006578.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01478A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CORIN |
| Target Synonyms | CRN; ATC2; Lrp4; PEE5; TMPRSS10; CORIN | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, A-549, HepG2, Mouse liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human CORIN (NP_006578.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS | Uniprot ID | Q9Y5Q5 |
Uniprot Id
Q9Y5Q5
Target Species
Human
Target Name
CORIN
Target Full Name
Atrial natriuretic peptide-converting enzyme
Target Function
Serine-type endopeptidase involved in atrial natriuretic peptide (NPPA) and brain natriuretic peptide (NPPB) processing. Converts through proteolytic cleavage the non-functional propeptides NPPA and NPPB into their active hormones, ANP and BNP(1-32) respectively, thereby regulating blood pressure in the heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney.; has weaker endopeptidase activity compared to isoform 1.
Target Involvement
Pre-eclampsia/eclampsia 5 (PEE5)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Note=May easily detached from the endothelial cell membrane.; [Isoform 2]: Cell membrane; Single-pass type II membrane protein. Note=Less efficiently targeted to the cell membrane compared to isoform 1.; [Atrial natriuretic peptide-converting enzyme, 180 kDa soluble fragment]: Secreted. Note=Soluble form produced following cleavage by ADAM10.; [Atrial natriuretic peptide-converting enzyme, 160 kDa soluble fragment]: Secreted. Note=Soluble form produced following autocatalytic cleavage.; [Atrial natriuretic peptide-converting enzyme, 100 kDa soluble fragment]: Secreted. Note=Soluble form produced following autocatalytic cleavage.
Target Protein Families
Peptidase S1 family
Target Tissue Specificity
Highly expressed in heart. Expressed in heart myocytes. Also expressed in pregnant uterus. Detected in blood, in plasma as well as in serum (at protein level).
Target Research Area
Cardiovascular
Target Synonyms
activated protease fragment; ATC 2; ATC2; Atrial natriuretic peptide-converting enzyme; Atrial natriuteric peptide converting enzyme; Corin; Corin serine peptidase; CORIN_HUMAN; CRN; Heart specific serine proteinase; Heart specific serine proteinase ATC2; Heart-specific serine proteinase ATC2; MGC119742; Pro ANP convertase; Pro ANP converting enzyme; Pro-ANP-converting enzyme; TMPRSS 10; TMPRSS10; Transmembrane protease serine 10
Target Background
This gene encodes a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. The encoded protein converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification