-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CPNE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human CPNE1 (NP_003906.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CPNE1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human CPNE1 (NP_003906.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04867A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CPNE1 |
| Target Synonyms | CPN1; COPN1; CPNE1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse brain, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human CPNE1 (NP_003906.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDY | Uniprot ID | Q99829 |
Uniprot Id
Q99829
Target Species
Human
Target Name
CPNE1
Target Full Name
Copine-1
Target Function
Calcium-dependent phospholipid-binding protein that plays a role in calcium-mediated intracellular processes. Involved in the TNF-alpha receptor signaling pathway in a calcium-dependent manner. Exhibits calcium-dependent phospholipid binding properties. Plays a role in neuronal progenitor cell differentiation; induces neurite outgrowth via a AKT-dependent signaling cascade and calcium-independent manner. May recruit target proteins to the cell membrane in a calcium-dependent manner. May function in membrane trafficking. Involved in TNF-alpha-induced NF-kappa-B transcriptional repression by inducing endoprotease processing of the transcription factor NF-kappa-B p65/RELA subunit. Also induces endoprotease processing of NF-kappa-B p50/NFKB1, p52/NFKB2, RELB and REL.
Target Subcellular Location
Nucleus. Cytoplasm. Cell membrane.
Target Protein Families
Copine family
Target Tissue Specificity
Expressed in neutrophils (at protein level). Widely expressed. Expressed in the brain. Expressed in neutrophil precursors from bone marrow and peripheral blood.
Target Synonyms
Copine 1; Copine I; Copine-1; Copine1; CopineI; COPN 1; COPN1; CPN 1; CPN1; CPNE 1; CPNE1; CPNE1_HUMAN; MGC1142
Target Background
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Alternate splicing results in multiple transcript variants encoding different proteins.
Notification