-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRACR2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRACR2A (NP_001138430.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CRACR2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRACR2A (NP_001138430.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05997A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRACR2A |
| Target Synonyms | RAB46; EFCAB4B; CRACR2A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CRACR2A (NP_001138430.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDF | Uniprot ID | Q9BSW2 |
Uniprot Id
Q9BSW2
Target Species
Human
Target Name
CRACR2A
Target Full Name
EF-hand calcium-binding domain-containing protein 4B
Target Function
Ca(2+)-binding protein that plays a key role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex.; Rab GTPase that mediates the trafficking of Weibel-Palade bodies (WPBs) to microtubule organizing center (MTOC) in endothelial cells in response to acute inflammatory stimuli. During histamine (but not thrombin) stimulation of endothelial cells, the dynein-bound form induces retrograde transport of a subset of WPBs along microtubules to the MTOC in a Ca(2+)-independent manner and its GTPase activity is essential for this function. Ca(2+)-regulated dynein adapter protein that activates dynein-mediated transport and dynein-dynactin motility on microtubules and regulates endosomal trafficking of CD47. Acts as an intracellular signaling module bridging two important T-cell receptor (TCR) signaling pathways, Ca(2+)-NFAT and JNK, to affect T-cell activation. In resting T-cells, is predominantly localized near TGN network in a GTP-bound form, upon TCR stimulation, localizes at the immunological synapse via interaction with VAV1 to activate downstream Ca(2+)-NFAT and JNK signaling pathways. Plays a role in T-helper 1 (Th1) cell differentiation and T-helper 17 (Th17) cell effector function. Plays a role in store-operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation.
Target Subcellular Location
[Isoform 1]: Cytoplasm.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center. Cell membrane. Golgi apparatus membrane. Golgi apparatus, trans-Golgi network membrane. Vesicle.
Target Protein Families
EFCAB4 family
Target Tissue Specificity
[Isoform 1]: Expressed in the Jurkat T-cell line.; [Isoform 2]: Expressed in endothelial cells. Expressed in Weibel-Palade bodies (which are P-selectin/SELP negative) in endothelial cells. Expressed in the Jurkat T-cell line.
Target Synonyms
CRACR2A; EFCAB4B; EF-hand calcium-binding domain-containing protein 4B; Calcium release-activated calcium channel regulator 2A; CRAC channel regulator 2A; Calcium release-activated channel regulator 2A
Target Background
Enables GTPase activity and calcium ion binding activity. Involved in several processes, including activation of store-operated calcium channel activity; positive regulation of JNK cascade; and store-operated calcium entry. Located in several cellular components, including Golgi apparatus; Weibel-Palade body; and immunological synapse.
Notification