-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CRCP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CRCP (NP_001035737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CRCP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CRCP (NP_001035737.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03913A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CRCP |
| Target Synonyms | C17; RCP; RCP9; RPC9; POLR3I; POLR3J; CGRPRCP; CGRP-RCP; CRCP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse testis, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human CRCP (NP_001035737.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA | Uniprot ID | O75575 |
Uniprot Id
O75575
Target Species
Human
Target Name
CRCP
Target Full Name
DNA-directed RNA polymerase III subunit RPC9
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway.; Accessory protein for the calcitonin gene-related peptide (CGRP) receptor. It modulates CGRP responsiveness in a variety of tissues.
Target Subcellular Location
Nucleus. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
Eukaryotic RPC9 RNA polymerase subunit family
Target Tissue Specificity
Ubiquitous. Most prevalent in testis.
Target Synonyms
Calcitonin gene related peptide receptor component; Calcitonin gene related peptide receptor component protein; Calcitonin gene-related peptide-receptor component protein; CGRP receptor component protein; CGRP-RCP; CGRP-receptor component protein; CGRPRCP; CRCP; DNA-directed RNA polymerase III subunit RPC9; HsC17; RCP; RCP9 ; RNA polymerase III subunit C9; RPC9_HUMAN
Target Background
This gene encodes a membrane protein that functions as part of a receptor complex for a small neuropeptide that increases intracellular cAMP levels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Notification