Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CREG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human CREG1 (NP_003842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CREG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human CREG1 (NP_003842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04649A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CREG1 |
| Target Synonyms | CREG; CREG1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human CREG1 (NP_003842.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LQLSVSNLQENPYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFA | Uniprot ID | O75629 |
Uniprot Id
O75629
Target Species
Human
Target Name
CREG1
Target Full Name
Protein CREG1
Target Function
May contribute to the transcriptional control of cell growth and differentiation. Antagonizes transcriptional activation and cellular transformation by the adenovirus E1A protein. The transcriptional control activity of cell growth requires interaction with IGF2R.
Target Subcellular Location
Secreted.
Target Protein Families
CREG family
Target Synonyms
Cellular repressor of E1A stimulated genes 1; Cellular repressor of E1A-stimulated genes 1; CREG; CREG1; CREG1_HUMAN; Protein CREG1
Target Background
The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
