-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCL10/IP-10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human CXCL10/IP-10 (NP_001556.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CXCL10/IP-10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human CXCL10/IP-10 (NP_001556.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14690A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCL10/IP-10 |
| Target Synonyms | C7; IFI10; INP10; IP-10; crg-2; mob-1; SCYB10; gIP-10; CXCL10/IP-10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-98 of human CXCL10/IP-10 (NP_001556.2) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP | Uniprot ID | P02778 |
Uniprot Id
P02778
Target Species
Human
Target Name
CXCL10
Target Full Name
C-X-C motif chemokine 10
Target Function
Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects. Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites. Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation. Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Tissue Specificity
Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus. Microglial cells produce CXCL10 in response to viral stimulation.
Target Research Area
Cancer, Immunology
Target Synonyms
Interferon gamma induced factor MOB1; mouse; homolog of; Interferon gamma induced protein 10; 10 kDa interferon gamma induced protein; 10 kDa interferon gamma-induced protein; C X C motif chemokine 10; C7; Chemokine (C X C motif) ligand 10; Chemokine CXC motif ligand 10; Crg 2; CRG2; CXCL10; CXCL10(1-73); CXL10_HUMAN; Gamma IP10; Gamma-IP10; gIP 10; GIP10; IFI10; INP 10; INP10; Interferon activated gene 10; Interferon activated gene 10; Interferon gamma induced cell line; Interferon inducible cytokine IP 10; Interferon inducible cytokine IP10; IP 10; IP-10; Mob 1; MOB1; Protein 10 from interferon (gamma) induced cell line; SCYB10; Small inducible cytokine B10; Small inducible cytokine B10 precursor; Small inducible cytokine subfamily B (Cys X Cys) member 10; Small inducible cytokine subfamily B CXC member 10; Small inducible cytokine subfamily B; member 10; Small-inducible cytokine B10
Target Background
This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection.
Notification