-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCL11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CXCL11 (NP_005400.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against CXCL11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CXCL11 (NP_005400.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-09522A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCL11 |
| Target Synonyms | IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; CXCL11 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CXCL11 (NP_005400.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF | Uniprot ID | O14625 |
Uniprot Id
O14625
Target Species
Human
Target Name
CXCL11
Target Full Name
C-X-C motif chemokine 11
Target Function
Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Tissue Specificity
High levels in peripheral blood leukocytes, pancreas and liver astrocytes. Moderate levels in thymus, spleen and lung. Low levels in placenta, prostate and small intestine. Also found in epidermal basal layer keratinocytes in skin disorders.
Target Synonyms
b R1; b-R1; Beta-R1; betaR1; C-X-C motif chemokine 11; Chemokine (C-X-C motif) ligand 11; Chemokine C-X-C motif ligand 11; CXC11; CXCL11; CXL11_HUMAN; H174; I TAC; I-TAC; Interferon gamma inducible protein 9; Interferon gamma-inducible protein 9; Interferon inducible T cell alpha chemoattractant; Interferon-inducible T-cell a chemoattractant I-TAC; Interferon-inducible T-cell alpha chemoattractant; IP 9; IP-9; IP9; ITAC; MGC102770; SCYB11; SCYB9B; Small inducible cytokine B11; Small inducible cytokine subfamily B (Cys-X-Cys) member 11; Small inducible cytokine subfamily B (Cys-X-Cys) member 9B; Small inducible cytokine subfamily B; member 11; Small inducible cytokine subfamily B; member 9B; Small-inducible cytokine B11
Target Background
Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This antimicrobial gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene. Two transcript variants encoding different isoforms have been found for this gene.
Notification