-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCL4/PF4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-101 of human CXCL4/CXCL4/PF4 (P02776) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CXCL4/PF4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-101 of human CXCL4/CXCL4/PF4 (P02776) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16207A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCL4/PF4 |
| Target Synonyms | PF-4; CXCL4; SCYB4; CXCL4/PF4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse spleen | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-101 of human CXCL4/CXCL4/PF4 (P02776). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES | Uniprot ID | P02776 |
Uniprot Id
P02776
Target Species
Human
Target Name
PF4
Target Full Name
Platelet factor 4
Target Function
Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation, the short form is a more potent inhibitor than the longer form.
Target Subcellular Location
Secreted.
Target Protein Families
Intercrine alpha (chemokine CxC) family
Target Synonyms
C-X-C motif chemokine 4; Chemokine (C X C motif) ligand 4; Chemokine (CXC motif) ligand 4; chemokine ligand 4; CXCL 4; CXCL4; Iroplact; MGC138298; Oncostatin A; Oncostatin-A; OncostatinA; PF 4; PF-4; PF4; Pf4a; Platelet factor 4; PLF4_HUMAN; SCYB 4; SCYB4; short form; Small inducible cytokine subfamily B; Small inducible cytokine subfamily member 4
Target Background
This gene encodes a member of the CXC chemokine family. This chemokine is released from the alpha granules of activated platelets in the form of a homotetramer which has high affinity for heparin and is involved in platelet aggregation. This protein is chemotactic for numerous other cell type and also functions as an inhibitor of hematopoiesis, angiogenesis and T-cell function. The protein also exhibits antimicrobial activity against Plasmodium falciparum.
Notification