-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 260-359 of human CXCR2 (NP_001548.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against CXCR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 260-359 of human CXCR2 (NP_001548.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12491A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCR2 |
| Target Synonyms | CD182; IL8R2; IL8RA; IL8RB; CMKAR2; WHIMS2; CDw128b; CXCR2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse lung, Mouse spleen, Rat lung, Rat spleen, THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 260-359 of human CXCR2 (NP_001548.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATEILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTT | Uniprot ID | P25025 |
Uniprot Id
P25025
Target Species
Human
Target Name
CXCR2
Target Full Name
C-X-C chemokine receptor type 2
Target Function
Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Binds to IL-8 with high affinity. Also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Research Area
Signal Transduction
Target Synonyms
C-X-C chemokine receptor type 2; CD 182; CD182; CD182 antigen; CDw128b; Chemokine (CXC) receptor 2; CMKAR2; CXC-R2; CXCR 2; CXCR-2; CXCR2; CXCR2_HUMAN; GRO/MGSA receptor; High affinity interleukin-8 receptor B; IL 8 receptor type 2; IL 8R B; IL-8 receptor type 2; IL-8R B; IL8 RB; IL8 receptor type 2; IL8R B; IL8R2; IL8RA; Interleukin 8 Receptor B; Interleukin 8 receptor; beta; Interleukin 8 receptor; type 2
Target Background
The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Alternatively spliced variants, encoding the same protein, have been identified.
Notification