Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CXCR5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 273-372 of human CXCR5 (NP_001707.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CXCR5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 273-372 of human CXCR5 (NP_001707.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09720A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CXCR5 |
| Target Synonyms | BLR1; CD185; MDR15; CXCR5 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | B cells, BT-474, Mouse liver, Raji | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CXCR5 (NP_001707.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF | Uniprot ID | P32302 |
Uniprot Id
P32302
Target Species
Human
Target Name
CXCR5
Target Full Name
C-X-C chemokine receptor type 5
Target Function
Cytokine receptor that binds to B-lymphocyte chemoattractant (BLC). Involved in B-cell migration into B-cell follicles of spleen and Peyer patches but not into those of mesenteric or peripheral lymph nodes. May have a regulatory function in Burkitt lymphoma (BL) lymphomagenesis and/or B-cell differentiation.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expression in mature B-cells and Burkitt lymphoma cells.
Target Research Area
Cancer
Target Synonyms
CXCR5; BLR1; MDR15; C-X-C chemokine receptor type 5; CXC-R5; CXCR-5; Burkitt lymphoma receptor 1; Monocyte-derived receptor 15; MDR-15; CD antigen CD185
Target Background
This gene encodes a multi-pass membrane protein that belongs to the CXC chemokine receptor family. It is expressed in mature B-cells and Burkitt's lymphoma. This cytokine receptor binds to B-lymphocyte chemoattractant (BLC), and is involved in B-cell migration into B-cell follicles of spleen and Peyer patches. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
