-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYBRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 215-286 of human CYBRD1 (NP_079119.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CYBRD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 215-286 of human CYBRD1 (NP_079119.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02148A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYBRD1 |
| Target Synonyms | DCYTB; FRRS3; CYB561A2; CYBRD1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 215-286 of human CYBRD1 (NP_079119.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM | Uniprot ID | Q53TN4 |
Uniprot Id
Q53TN4
Target Species
Human
Target Name
CYBRD1
Target Full Name
Plasma membrane ascorbate-dependent reductase CYBRD1
Target Function
Plasma membrane reductase that uses cytoplasmic ascorbate as an electron donor to reduce extracellular Fe(3+) into Fe(2+). Probably functions in dietary iron absorption at the brush border of duodenal enterocytes by producing Fe(2+), the divalent form of iron that can be transported into enterocytes. It is also able to reduce extracellular monodehydro-L-ascorbate and may be involved in extracellular ascorbate regeneration by erythrocytes in blood. May also act as a ferrireductase in airway epithelial cells. May also function as a cupric transmembrane reductase.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.
Target Tissue Specificity
Present in erythrocyte membranes (at protein level). Also expressed in respiratory epithelium.
Target Synonyms
CYBRD1; DCYTB; FRRS3; Plasma membrane ascorbate-dependent reductase CYBRD1; Cytochrome b reductase 1; Duodenal cytochrome b; Ferric-chelate reductase 3
Target Background
This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption.
Notification