-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cyclin A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human CCNA1 (NP_001104515.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cyclin A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human CCNA1 (NP_001104515.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05584A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cyclin A1 |
| Target Synonyms | CT146; Cyclin A1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human CCNA1 (NP_001104515.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYL | Uniprot ID | P78396 |
Uniprot Id
P78396
Target Species
Human
Target Name
CCNA1
Target Full Name
Cyclin-A1
Target Function
May be involved in the control of the cell cycle at the G1/S (start) and G2/M (mitosis) transitions. May primarily function in the control of the germline meiotic cell cycle and additionally in the control of mitotic cell cycle in some somatic cells.
Target Subcellular Location
Nucleus.
Target Protein Families
Cyclin family, Cyclin AB subfamily
Target Tissue Specificity
Very high levels in testis and very low levels in brain. Also found in myeloid leukemia cell lines.
Target Research Area
Cancer
Target Synonyms
CCN A1; CCNA 1; Ccna1; CCNA1_HUMAN; Cyclin-A1; CyclinA1; G2/mitotic specific cyclin A1; MGC132235; MGC159139
Target Background
The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification