Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYGB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CYGB (NP_599030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CYGB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CYGB (NP_599030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05818A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYGB |
| Target Synonyms | HGB; STAP; CYGB | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CYGB (NP_599030.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP | Uniprot ID | Q8WWM9 |
Uniprot Id
Q8WWM9
Target Species
Human
Target Name
CYGB
Target Full Name
Cytoglobin
Target Function
May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Globin family
Target Tissue Specificity
Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
Target Research Area
Transport
Target Synonyms
Cygb; CYGB_HUMAN; Cytoglobin; Hgb; Histoglobin; STAP; Stellate cell activation associated protein ; Stellate cell activation-associated protein
Target Background
This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protection during oxidative stress. This gene is located on chromosome 17 in the same region as a retinal gene which is mutated in progressive rod-cone degeneration, but in the opposite orientation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
