-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYP39A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP39A1 (NP_057677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CYP39A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP39A1 (NP_057677.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10621A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYP39A1 |
| Form | Liquid | Species Reactivity | Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat brain, Mouse pancreas |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CYP39A1 (NP_057677.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELISPTVIIILGCLALFLLLQRKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNI | Uniprot ID | Q9NYL5 |
Uniprot Id
Q9NYL5
Target Species
Human
Target Name
CYP39A1
Target Full Name
24-hydroxycholesterol 7-alpha-hydroxylase
Target Function
A cytochrome P450 monooxygenase involved in neural cholesterol clearance through bile acid synthesis. Catalyzes 7-alpha hydroxylation of (24S)-hydroxycholesterol, a neural oxysterol that is metabolized to bile acids in the liver. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome membrane; Multi-pass membrane protein.
Target Protein Families
Cytochrome P450 family
Target Tissue Specificity
Liver specific.
Target Synonyms
24 hydroxycholesterol 7 alpha hydroxylase; 24-hydroxycholesterol 7-alpha-hydroxylase; CP39A_HUMAN; Cyp39a1; cytochrome P450 family 39; subfamily A polypeptide 1; Cytochrome P450 39A1; cytochrome P450 subfamily XXXIX (oxysterol 7 alpha hydroxylase) polypeptide 1; Cytochrome P450; family 39; subfamily a; polypeptide 1; hCYP39A1; Oxysterol 7 alpha hydroxylase ; Oxysterol 7-alpha-hydroxylase; oxysterol 7alpha hydroxylase
Target Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is involved in the conversion of cholesterol to bile acids. Its substrates include the oxysterols 25-hydroxycholesterol, 27-hydroxycholesterol and 24-hydroxycholesterol. Alternate splicing results in multiple transcript variants.
Notification