-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYTH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH1 (NP_004753.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against CYTH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH1 (NP_004753.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05119A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYTH1 |
| Target Synonyms | B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1; CYTH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse brain, Mouse spleen, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human CYTH1 (NP_004753.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGR | Uniprot ID | Q15438 |
Uniprot Id
Q15438
Target Species
Human
Target Name
CYTH1
Target Full Name
Cytohesin-1
Target Function
Promotes guanine-nucleotide exchange on ARF1, ARF5 and ARF6. Promotes the activation of ARF factors through replacement of GDP with GTP. Plays an important role in membrane trafficking, during junctional remodeling and epithelial polarization, through regulation of ARF6 activity.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cytoplasm, cytosol. Cell junction, tight junction. Cell junction, adherens junction.
Target Tissue Specificity
Ubiquitous.
Target Synonyms
B2 1; CLM1; CTH 1; CYH1_HUMAN; CYTH1; CYTIP; Cytoadhesin 1; CYTOHESIN 1; Cytohesin-1; D17S811E; FLJ34050; FLJ41900; Homolog of secretory protein SEC7; KIAA4240; mKIAA4240; mSec7 1; OTTHUMP00000196778; OTTHUMP00000196779; PH; PH; SEC7 and coiled-coil domain containing protein 1; Pleckstrin homology Sec7 and coiled/coil domains 1 ; Pleckstrin homology Sec7 and coiled/coil domains protein 1; Pleckstrin homology; Sec7 and coiled coil domains 1; PSCD1; SEC7 and coiled-coil domain-containing protein 1; Sec7; SEC7 homolog A; SEC7 homolog B2 1; SEC7 homolog B2-1; SEC7; yeast; homolog of; Sec7a
Target Background
The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants.
Notification