Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 12 (KRT12) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-494 of human Cytokeratin 12 (Cytokeratin 12 (KRT12)) (NP_000214.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cytokeratin 12 (KRT12) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 295-494 of human Cytokeratin 12 (Cytokeratin 12 (KRT12)) (NP_000214.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00625A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 12 (KRT12) |
| Target Synonyms | K12; MECD1; Cytokeratin 12 (KRT12) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 295-494 of human Cytokeratin 12 (Cytokeratin 12 (KRT12)) (NP_000214.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM | Uniprot ID | Q99456 |
Uniprot Id
Q99456
Target Species
Human
Target Name
KRT12
Target Full Name
Keratin, type I cytoskeletal 12
Target Function
Involved in corneal epithelium organization, integrity and corneal keratin expression.
Target Involvement
Corneal dystrophy, Meesmann (MECD)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in the corneal epithelium (at protein level).
Target Synonyms
CK-12; Cytokeratin-12; K12; K1C12_HUMAN; Keratin 12; Keratin; Keratin; type I cytoskeletal 12; Keratin-12; KRT12; type I cytoskeletal 12
Target Background
KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
