-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 16 (KRT16) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 16 (KRT16) (P08779) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cytokeratin 16 (KRT16) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 16 (KRT16) (P08779) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15914A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 16 (KRT16) |
| Target Synonyms | K16; PC1; CK16; K1CP; NEPPK; FNEPPK; KRT16A; Cytokeratin 16 (KRT16) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse large intestine | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 16 (KRT16) (P08779). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSRFSSGGACGLGGGYGGGFSSSSSFGSGFGGGYGGGLGAGFGGGLGA | Uniprot ID | P08779 |
Uniprot Id
P08779
Target Species
Human
Target Name
KRT16
Target Full Name
Keratin, type I cytoskeletal 16
Target Function
Epidermis-specific type I keratin that plays a key role in skin. Acts as a regulator of innate immunity in response to skin barrier breach: required for some inflammatory checkpoint for the skin barrier maintenance.
Target Involvement
Pachyonychia congenita 1 (PC1); Keratoderma, palmoplantar, non-epidermolytic, focal 1 (FNEPPK1)
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in the corneal epithelium (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
CK 16; CK-16; CK16; Cytokeratin 16; Cytokeratin-16; Cytokeratin16; FNEPPK; Focal non epidermolytic palmoplantar keratoderma; K 16; K16; K1C16_HUMAN; K1CP; Keratin 1 type I; Keratin 16; Keratin; Keratin type I cytoskeletal 16; Keratin-16; Keratin16; KRT 16; Krt16; KRT16A; NEPPK; PC1; type I cytoskeletal 16
Target Background
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region of chromosome 17q12-q21. This keratin has been coexpressed with keratin 14 in a number of epithelial tissues, including esophagus, tongue, and hair follicles. Mutations in this gene are associated with type 1 pachyonychia congenita, non-epidermolytic palmoplantar keratoderma and unilateral palmoplantar verrucous nevus.
Notification