-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 17 (KRT17) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (KRT17) (Q04695) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Cytokeratin 17 (KRT17) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (KRT17) (Q04695) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13506A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 17 (KRT17) |
| Target Synonyms | PC; K17; PC2; 39.1; CK-17; PCHC1; Cytokeratin 17 (KRT17) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cytokeratin 17 (KRT17) (Q04695). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD | Uniprot ID | Q04695 |
Uniprot Id
Q04695
Target Species
Human
Target Name
KRT17
Target Full Name
Keratin, type I cytoskeletal 17
Target Function
Type I keratin involved in the formation and maintenance of various skin appendages, specifically in determining shape and orientation of hair. Required for the correct growth of hair follicles, in particular for the persistence of the anagen (growth) state. Modulates the function of TNF-alpha in the specific context of hair cycling. Regulates protein synthesis and epithelial cell growth through binding to the adapter protein SFN and by stimulating Akt/mTOR pathway. Involved in tissue repair. May be a marker of basal cell differentiation in complex epithelia and therefore indicative of a certain type of epithelial 'stem cells'. Acts as a promoter of epithelial proliferation by acting a regulator of immune response in skin: promotes Th1/Th17-dominated immune environment contributing to the development of basaloid skin tumors. May act as an autoantigen in the immunopathogenesis of psoriasis, with certain peptide regions being a major target for autoreactive T-cells and hence causing their proliferation.
Target Involvement
Pachyonychia congenita 2 (PC2); Steatocystoma multiplex (SM)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed in the outer root sheath and medulla region of hair follicle specifically from eyebrow and beard, digital pulp, nail matrix and nail bed epithelium, mucosal stratified squamous epithelia and in basal cells of oral epithelium, palmoplantar epider
Target Synonyms
PC; K17; PC2; 39.1; CK-17; PCHC1; Cytokeratin 17 (KRT17)
Target Background
This gene encodes the type I intermediate filament chain keratin 17, expressed in nail bed, hair follicle, sebaceous glands, and other epidermal appendages. Mutations in this gene lead to Jackson-Lawler type pachyonychia congenita and steatocystoma multiplex.
Notification