-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 20 (KRT20) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 245-424 of human Cytokeratin 20 (KRT20) (NP_061883.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Cytokeratin 20 (KRT20) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 245-424 of human Cytokeratin 20 (KRT20) (NP_061883.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07761A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 20 (KRT20) |
| Target Synonyms | K20; CD20; CK20; CK-20; KRT21; Cytokeratin 20 (KRT20) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse intestine | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 245-424 of human Cytokeratin 20 (KRT20) (NP_061883.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KYEVMAQKNLQEAKEQFERQTAVLQQQVTVNTEELKGTEVQLTELRRTSQSLEIELQSHLSMKESLEHTLEETKARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKTRLEQEIATYRRLLEGEDVKTTEYQLSTLEERDIKKTRKIKTVVQEVVDGKVVSSEVKEVEENI | Uniprot ID | P35900 |
Uniprot Id
P35900
Target Species
Human
Target Name
KRT20
Target Full Name
Keratin, type I cytoskeletal 20
Target Function
Plays a significant role in maintaining keratin filament organization in intestinal epithelia. When phosphorylated, plays a role in the secretion of mucin in the small intestine.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Intermediate filament family
Target Tissue Specificity
Expressed predominantly in the intestinal epithelium. Expressed in luminal cells of colonic mucosa. Also expressed in the Merkel cells of keratinized oral mucosa; specifically at the tips of some rete ridges of the gingival mucosa, in the basal layer of t
Target Synonyms
CD20; CK 20 ; CK-20; CK20; Cytokeratin-20; Cytokeratin20 ; K1C20_HUMAN; K20; KA20; Keratin 20; keratin 20, type I; keratin 21, rat, homolog of; Keratin; Keratin type I cytoskeletal 20 ; Keratin-20; Keratin20; KRT 20; KRT 21; KRT20; KRT21 ; MGC35423; OTTHUMP00000164518; Protein IT; type I cytoskeletal 20
Target Background
The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21.
Notification