-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAAM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DAAM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09321A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAAM2 |
| Target Synonyms | NPHS24; dJ90A20A.1; DAAM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, A375, Mouse brain, Mouse lung, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-86 of human DAAM2 (NP_056160.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKK | Uniprot ID | Q86T65 |
Uniprot Id
Q86T65
Target Species
Human
Target Name
DAAM2
Target Full Name
Disheveled-associated activator of morphogenesis 2
Target Function
Key regulator of the Wnt signaling pathway, which is required for various processes during development, such as dorsal patterning, determination of left/right symmetry or myelination in the central nervous system. Acts downstream of Wnt ligands and upstream of beta-catenin (CTNNB1). Required for canonical Wnt signaling pathway during patterning in the dorsal spinal cord by promoting the aggregation of Disheveled (Dvl) complexes, thereby clustering and formation of Wnt receptor signalosomes and potentiating Wnt activity. During dorsal patterning of the spinal cord, inhibits oligodendrocytes differentiation via interaction with PIP5K1A. Also regulates non-canonical Wnt signaling pathway. Acts downstream of PITX2 in the developing gut and is required for left/right asymmetry within dorsal mesentery: affects mesenchymal condensation by lengthening cadherin-based junctions through WNT5A and non-canonical Wnt signaling, inducing polarized condensation in the left dorsal mesentery necessary to initiate gut rotation. Together with DAAM1, required for myocardial maturation and sarcomere assembly.
Target Protein Families
Formin homology family
Target Tissue Specificity
Expressed in most tissues examined.
Target Synonyms
DAAM2; DAAM2_HUMAN; Disheveled-associated activator of morphogenesis 2; dishevelled associated activator of morphogenesis 2; dJ90A20A.1; KIAA0381; MGC90515; RP1 278E11.1
Target Background
Predicted to enable actin binding activity and small GTPase binding activity. Predicted to be involved in nervous system development and regulation of Wnt signaling pathway. Predicted to act upstream of or within determination of left/right symmetry. Located in extracellular exosome.
Notification