-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DAG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 776-895 of human DAG1 (NP_001171108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against DAG1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 776-895 of human DAG1 (NP_001171108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-08983A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DAG1 |
| Target Synonyms | A3a; DAG; AGRNR; 156DAG; MDDGA9; MDDGC7; MDDGC9; LGMDR16; DAG1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 776-895 of human DAG1 (NP_001171108.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP | Uniprot ID | Q14118 |
Uniprot Id
Q14118
Target Species
Human
Target Name
DAG1
Target Full Name
Dystroglycan 1
Target Function
The dystroglycan complex is involved in a number of processes including laminin and basement membrane assembly, sarcolemmal stability, cell survival, peripheral nerve myelination, nodal structure, cell migration, and epithelial polarization.; Extracellular peripheral glycoprotein that acts as a receptor for extracellular matrix proteins containing laminin-G domains. Receptor for laminin-2 (LAMA2) and agrin in peripheral nerve Schwann cells. Also acts as a receptor for laminin LAMA5.; Transmembrane protein that plays important roles in connecting the extracellular matrix to the cytoskeleton. Acts as a cell adhesion receptor in both muscle and non-muscle tissues. Receptor for both DMD and UTRN and, through these interactions, scaffolds axin to the cytoskeleton. Also functions in cell adhesion-mediated signaling and implicated in cell polarity.; (Microbial infection) Acts as a receptor for lassa virus and lymphocytic choriomeningitis virus glycoprotein and class C new-world arenaviruses. Acts as a Schwann cell receptor for Mycobacterium leprae, the causative organism of leprosy, but only in the presence of the G-domain of LAMA2.
Target Involvement
Muscular dystrophy-dystroglycanopathy limb-girdle C9 (MDDGC9); Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A9 (MDDGA9)
Target Subcellular Location
[Alpha-dystroglycan]: Secreted, extracellular space.; [Beta-dystroglycan]: Cell membrane; Single-pass type I membrane protein. Cytoplasm, cytoskeleton. Nucleus, nucleoplasm. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane.
Target Tissue Specificity
Expressed in a variety of fetal and adult tissues. In epidermal tissue, located to the basement membrane. Also expressed in keratinocytes and fibroblasts.
Target Research Area
Neuroscience
Target Synonyms
156DAG; A3a; AGRNR; Alpha dystroglycan; Alpha-DG; Beta-DG; Beta-dystroglycan; DAG; Dag1; DAG1_HUMAN; Dystroglycan 1 (dystrophin associated glycoprotein 1); Dystroglycan; Dystrophin associated glycoprotein 1; Dystrophin-associated glycoprotein 1; OTTHUMP00000210857; OTTHUMP00000210858
Target Background
This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein.
Notification