-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DDB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1140 of human DDB1 (NP_001914.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against DDB1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1000-1140 of human DDB1 (NP_001914.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-04054A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DDB1 |
| Target Synonyms | XPE; DDBA; XAP1; XPCE; XPE-BF; UV-DDB1; WHIKERS; DDB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, BT-474, Hep G2, Jurkat, NCI-H460, Rat testis, U-251MG | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1000-1140 of human DDB1 (NP_001914.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH | Uniprot ID | Q16531 |
Uniprot Id
Q16531
Target Species
Human
Target Name
DDB1
Target Full Name
DNA damage-binding protein 1
Target Function
Protein, which is both involved in DNA repair and protein ubiquitination, as part of the UV-DDB complex and DCX (DDB1-CUL4-X-box) complexes, respectively. Core component of the UV-DDB complex (UV-damaged DNA-binding protein complex), a complex that recognizes UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also functions as a component of numerous distinct DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. DCX(DDB2) (also known as DDB1-CUL4-ROC1, CUL4-DDB-ROC1 and CUL4-DDB-RBX1) may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. DCX(DDB2) also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. DCX(DTL) plays a role in PCNA-dependent polyubiquitination of CDT1 and MDM2-dependent ubiquitination of TP53 in response to radiation-induced DNA damage and during DNA replication. DCX(ERCC8) (the CSA complex) plays a role in transcription-coupled repair (TCR). The DDB1-CUL4A-DTL E3 ligase complex regulates the circadian clock function by mediating the ubiquitination and degradation of CRY1. DDB1-mediated CRY1 degradation promotes FOXO1 protein stability and FOXO1-mediated gluconeogenesis in the liver.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
DDB1 family
Target Synonyms
Damage specific DNA binding protein 1; Damage-specific DNA-binding protein 1; DDB 1; DDB p127 subunit; Ddb1; DDB1_HUMAN; DDBa; DNA damage binding protein 1; DNA damage-binding protein 1; DNA damage-binding protein a; HBV X-associated protein 1; UV damaged DNA binding factor; UV damaged DNA binding protein 1; UV DDB 1; UV DDB1 ; UV-damaged DNA-binding factor; UV-damaged DNA-binding protein 1; UV-DDB 1; X associated protein 1; XAP 1; XAP-1; XAP1; Xeroderma pigmentosum group E complementing protein; Xeroderma pigmentosum group E-complementing protein; XPCe; XPE; XPE BF; XPE binding factor; XPE-BF; XPE-binding factor
Target Background
The protein encoded by this gene is the large subunit (p127) of the heterodimeric DNA damage-binding (DDB) complex while another protein (p48) forms the small subunit. This protein complex functions in nucleotide-excision repair and binds to DNA following UV damage. Defective activity of this complex causes the repair defect in patients with xeroderma pigmentosum complementation group E (XPE) - an autosomal recessive disorder characterized by photosensitivity and early onset of carcinomas. However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients. The protein encoded by this gene also functions as an adaptor molecule for the cullin 4 (CUL4) ubiquitin E3 ligase complex by facilitating the binding of substrates to this complex and the ubiquitination of proteins.
Notification