Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DIP2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human DIP2C (NP_055789.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against DIP2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human DIP2C (NP_055789.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07264A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DIP2C |
| Target Synonyms | KIAA0934; DIP2C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Rat heart, 293T, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-260 of human DIP2C (NP_055789.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAKHKERKMAVPMPSKRRSLVVQTSMDAYTPPDTSSGSEDEGSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHIENHSAPPDVTTYTSEHSIQVERPQGSTGSRTAPKYGNAELMETGDGVPVSSRVSAKIQQ | Uniprot ID | Q9Y2E4 |
Uniprot Id
Q9Y2E4
Target Species
Human
Target Name
DIP2C
Target Full Name
Disco-interacting protein 2 homolog C
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
DIP2 homolog C; DIP2C; DIP2C_HUMAN; Disco-interacting protein 2 homolog C; KIAA0934; RP11-486H9.2
Target Background
This gene encodes a member of the disco-interacting protein homolog 2 family. The protein shares strong similarity with a Drosophila protein which interacts with the transcription factor disco and is expressed in the nervous system.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
