-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAJC10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 614-793 of human DNAJC10 (NP_061854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNAJC10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 614-793 of human DNAJC10 (NP_061854.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02275A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAJC10 |
| Target Synonyms | JPDI; MTHr; ERdj5; PDIA19; DNAJC10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse lung, Mouse pancreas, Raji, SGC-7901, SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 614-793 of human DNAJC10 (NP_061854.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYHYHSYNGWNRDAYSLRIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL | Uniprot ID | Q8IXB1 |
Uniprot Id
Q8IXB1
Target Species
Human
Target Name
DNAJC10
Target Full Name
DnaJ homolog subfamily C member 10
Target Function
Endoplasmic reticulum disulfide reductase involved both in the correct folding of proteins and degradation of misfolded proteins. Required for efficient folding of proteins in the endoplasmic reticulum by catalyzing the removal of non-native disulfide bonds formed during the folding of proteins, such as LDLR. Also involved in endoplasmic reticulum-associated degradation (ERAD) by reducing incorrect disulfide bonds in misfolded glycoproteins recognized by EDEM1. Interaction with HSPA5 is required its activity, not for the disulfide reductase activity, but to facilitate the release of DNAJC10 from its substrate. Promotes apoptotic signaling pathway in response to endoplasmic reticulum stress.
Target Subcellular Location
Endoplasmic reticulum lumen.
Target Synonyms
DNAJC10; ERDJ5; UNQ495/PRO1012DnaJ homolog subfamily C member 10; EC 1.8.4.-; Endoplasmic reticulum DNA J domain-containing protein 5; ER-resident protein ERdj5; ERdj5; Macrothioredoxin; MTHr
Target Background
This gene encodes an endoplasmic reticulum co-chaperone which is part of the endoplasmic reticulum-associated degradation complex involved in recognizing and degrading misfolded proteins. The encoded protein reduces incorrect disulfide bonds in misfolded glycoproteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Notification