Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human DNAL4 (NP_005731.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNAL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human DNAL4 (NP_005731.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02243A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAL4 |
| Target Synonyms | MRMV3; PIG27; DNAL4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human DNAL4 (NP_005731.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS | Uniprot ID | O96015 |
Uniprot Id
O96015
Target Species
Human
Target Name
DNAL4
Target Full Name
Dynein axonemal light chain 4
Target Function
Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity.
Target Involvement
Mirror movements 3 (MRMV3)
Target Subcellular Location
Cytoplasm, cytoskeleton, cilium axoneme.
Target Protein Families
Dynein light chain family
Target Synonyms
D15Ertd424e; Dnal4; DNAL4_HUMAN; Dnalc4 ; Dynein axonemal light chain 4; Dynein light chain 4; axonemal; Dynein light chain; outer arm 4; Dynein; axonemal; light 4; Dynein; axonemal; light polypeptide 4; MGC105573; PIG27; Proliferation inducing gene 27; Proliferation inducing protein 27
Target Background
This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
