-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DOCK7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DOCK7 (NP_001354490.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DOCK7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DOCK7 (NP_001354490.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02110A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DOCK7 |
| Target Synonyms | ZIR2; DEE23; EIEE23; DOCK7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Jurkat, Mouse brain, Mouse ovary, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DOCK7 (NP_001354490.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VSAVPEESEMDPHVRDCIRSYTEDWAIVIRKYHKLGTGFNPNTLDKQKERQKGLPKQVFESDEAPDGNSYQDDQDDLKRRSMSIDDTPRGSWACSIFDLKN | Uniprot ID | Q96N67 |
Uniprot Id
Q96N67
Target Species
Human
Target Name
DOCK7
Target Full Name
Dedicator of cytokinesis protein 7
Target Function
Functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. Does not have a GEF activity for CDC42. Required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization. As part of the DISP complex, may regulate the association of septins with actin and thereby regulate the actin cytoskeleton. Has a role in pigmentation. Involved in the regulation of cortical neurogenesis through the control of radial glial cells (RGCs) proliferation versus differentiation; negatively regulates the basal-to-apical interkinetic nuclear migration of RGCs by antagonizing the microtubule growth-promoting function of TACC3.
Target Involvement
Epileptic encephalopathy, early infantile, 23 (EIEE23)
Target Subcellular Location
Cell projection, axon. Note=Enriched in the developing axons of hippocampal neurons.
Target Protein Families
DOCK family
Target Tissue Specificity
Widely expressed.
Target Synonyms
DOCK7; KIAA1771Dedicator of cytokinesis protein 7
Target Background
The protein encoded by this gene is a guanine nucleotide exchange factor (GEF) that plays a role in axon formation and neuronal polarization. The encoded protein displays GEF activity toward RAC1 and RAC3 Rho small GTPases but not toward CDC42. Several transcript variants encoding different isoforms have been found for this gene.
Notification