Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DRAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRAM1 (NP_060840.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DRAM1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRAM1 (NP_060840.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05037A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DRAM1 |
| Target Synonyms | DRAM; DRAM1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human DRAM1 (NP_060840.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLVGCFGMGIVANFQELAVPVVHDGGALLAFVCGVVYTLLQSIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASLISITKLEWNPREKDYVYHVV | Uniprot ID | Q8N682 |
Uniprot Id
Q8N682
Target Species
Human
Target Name
DRAM1
Target Full Name
DNA damage-regulated autophagy modulator protein 1
Target Function
Lysosomal modulator of autophagy that plays a central role in p53/TP53-mediated apoptosis. Not involved in p73/TP73-mediated autophagy.
Target Subcellular Location
Lysosome membrane; Multi-pass membrane protein.
Target Protein Families
DRAM/TMEM150 family
Target Synonyms
DRAM1; DRAM; DNA damage-regulated autophagy modulator protein 1; Damage-regulated autophagy modulator
Target Background
This gene is regulated as part of the p53 tumor suppressor pathway. The gene encodes a lysosomal membrane protein that is required for the induction of autophagy by the pathway. Decreased transcriptional expression of this gene is associated with various tumors. This gene has a pseudogene on chromosome 4.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
