Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DSG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-630 of human DSG4 (NP_817123.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DSG4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 480-630 of human DSG4 (NP_817123.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01604A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DSG4 |
| Target Synonyms | LAH; HYPT6; CDGF13; CDHF13; DSG4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-375, BxPC-3, DU145, Mouse pancreas, Mouse small intestine, Rat pancreas | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 480-630 of human DSG4 (NP_817123.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TGTICIEVPDINDYCPNIFPERRTICIDSPSVLISVNEHSYGSPFTFCVVDEPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGAAGIYTEDITGDTYGPVTEDQAGVSNVGLGP | Uniprot ID | Q86SJ6 |
Uniprot Id
Q86SJ6
Target Species
Human
Target Name
DSG4
Target Full Name
Desmoglein-4
Target Function
Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes.
Target Involvement
Hypotrichosis 6 (HYPT6)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell junction, desmosome.
Target Tissue Specificity
Highly expressed in skin, testis and prostate; less in salivary gland. In scalp follicles, present in the inner root sheath (IRS) and all layers of the matrix and precortex.
Target Synonyms
DSG4; CDHF13; Desmoglein-4; Cadherin family member 13
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
