Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-220 of human EARS2 (NP_001295140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EARS2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 42-220 of human EARS2 (NP_001295140.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05345A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EARS2 |
| Target Synonyms | MSE1; gluRS; COXPD12; mtGlnRS; EARS2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 42-220 of human EARS2 (NP_001295140.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | APSPTGFLHLGGLRTALYNYIFAKKYQGSFILRLEDTDQTRVVPGAAENIEDMLEWAGIPPDESPRRGGPAGPYQQSQRLELYAQATEALLKTGAAYPCFCSPQRLELLKKEALRNHQTPRYDNRCRNMSQEQVAQKLAKDPKPAIRFRLEQVVPAFQDLVYGWNRHEVASVEGDPVIM | Uniprot ID | Q5JPH6 |
Uniprot Id
Q5JPH6
Target Species
Human
Target Name
EARS2
Target Full Name
Nondiscriminating glutamyl-tRNA synthetase EARS2, mitochondrial
Target Function
Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).
Target Involvement
Combined oxidative phosphorylation deficiency 12 (COXPD12)
Target Subcellular Location
Mitochondrion matrix.
Target Protein Families
Class-I aminoacyl-tRNA synthetase family, Glutamate--tRNA ligase type 1 subfamily
Target Synonyms
3230401I01Rik; AL024049; COXPD12; EARS 2; ears2; GluRS; Glutamate--tRNA ligase; Glutamyl tRNA synthetase 2 mitochondrial; KIAA1970; mitochondrial; mKIAA1970; MSE1; Probable glutamyl tRNA synthetase; mitochondrial ; Probable glutamyl-tRNA synthetase; RGD1307904; SYEM_HUMAN
Target Background
This gene encodes a member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of glutamate to tRNA molecules. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency 12 (COXPD12). Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
