-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBP (NP_006570.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EBP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBP (NP_006570.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05421A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EBP |
| Target Synonyms | CPX; CHO2; CPXD; MEND; CDPX2; EBP | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human EBP (NP_006570.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGRAAVVPLGTWRRLSLCWFAVCGFIHLVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITACLWGPLSLWVVIAFLRQHPLRFIL | Uniprot ID | Q15125 |
Uniprot Id
Q15125
Target Species
Human
Target Name
EBP
Target Full Name
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase
Target Function
Catalyzes the conversion of Delta(8)-sterols to their corresponding Delta(7)-isomers.
Target Involvement
Chondrodysplasia punctata 2, X-linked dominant (CDPX2); MEND syndrome (MEND)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Nucleus envelope. Cytoplasmic vesicle.
Target Protein Families
EBP family
Target Synonyms
EBP; 3-beta-hydroxysteroid-Delta(8,Delta(7-isomerase; Cholestenol Delta-isomerase; Delta(8-Delta(7 sterol isomerase; D8-D7 sterol isomerase; Emopamil-binding protein
Target Background
The protein encoded by this gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome).
Notification