Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EDIL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human EDIL3 (NP_005702.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EDIL3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 350-450 of human EDIL3 (NP_005702.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06267A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EDIL3 |
| Target Synonyms | DEL1; EDIL3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 350-450 of human EDIL3 (NP_005702.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPP | Uniprot ID | O43854 |
Uniprot Id
O43854
Target Species
Human
Target Name
EDIL3
Target Full Name
EGF-like repeat and discoidin I-like domain-containing protein 3
Target Function
Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
Target Subcellular Location
Secreted.
Target Research Area
Cardiovascular
Target Synonyms
DEL1 ; Developmental endothelial locus 1 ; Developmentally regulated endothelial cell locus 1 protein; Developmentally-regulated endothelial cell locus 1 protein; Edil3; EDIL3_HUMAN; EGF like repeat and discoidin I like domain containing protein 3; EGF like repeats and discoidin I like domains 3; EGF like repeats and discoidin I like domains protein 3; EGF-like repeat and discoidin I-like domain-containing protein 3; Integrin binding protein DEL1; Integrin-binding protein DEL1
Target Background
The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
