-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EHMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 680-813 of human EHMT2 (NP_006700.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EHMT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 680-813 of human EHMT2 (NP_006700.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11300A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EHMT2 |
| Target Synonyms | G9A; BAT8; GAT8; NG36; KMT1C; C6orf30; EHMT2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 680-813 of human EHMT2 (NP_006700.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWTPIIWAAEHKHIEVIRMLLTRGADVTL | Uniprot ID | Q96KQ7 |
Uniprot Id
Q96KQ7
Target Species
Human
Target Name
EHMT2
Target Full Name
Histone-lysine N-methyltransferase EHMT2
Target Function
Histone methyltransferase that specifically mono- and dimethylates 'Lys-9' of histone H3 (H3K9me1 and H3K9me2, respectively) in euchromatin. H3K9me represents a specific tag for epigenetic transcriptional repression by recruiting HP1 proteins to methylated histones. Also mediates monomethylation of 'Lys-56' of histone H3 (H3K56me1) in G1 phase, leading to promote interaction between histone H3 and PCNA and regulating DNA replication. Also weakly methylates 'Lys-27' of histone H3 (H3K27me). Also required for DNA methylation, the histone methyltransferase activity is not required for DNA methylation, suggesting that these 2 activities function independently. Probably targeted to histone H3 by different DNA-binding proteins like E2F6, MGA, MAX and/or DP1. May also methylate histone H1. In addition to the histone methyltransferase activity, also methylates non-histone proteins: mediates dimethylation of 'Lys-373' of p53/TP53. Also methylates CDYL, WIZ, ACIN1, DNMT1, HDAC1, ERCC6, KLF12 and itself.
Target Subcellular Location
Nucleus. Chromosome. Note=Associates with euchromatic regions. Does not associate with heterochromatin.
Target Protein Families
Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, Suvar3-9 subfamily
Target Tissue Specificity
Expressed in all tissues examined, with high levels in fetal liver, thymus, lymph node, spleen and peripheral blood leukocytes and lower level in bone marrow.
Target Synonyms
Ankyrin repeat containing protein; Bat 8; Bat8; C6orf30; DKFZp686H08213; EHMT 2; Ehmt2; EHMT2_HUMAN; Euchromatic histone lysine methyltransferase 2; Euchromatic histone lysine N methyltransferase 2; Euchromatic histone-lysine N-methyltransferase 2; FLJ35547; G 9a; G9 a; G9a protein; G9A; G9A histone methyltransferase; GAT8; H3 K9 HMTase 3; H3-K9-HMTase 3; Histone H3 K9 methyltransferase 3; Histone H3 K9 methyltransferase3; Histone H3-K9 methyltransferase 3; Histone lysine N methyltransferase; Histone lysine N methyltransferase EHMT2; Histone lysine N methyltransferase; H3 lysine 9 specific 3; Histone lysine N methyltransferase; H3 lysine 9 specific3; Histone-lysine N-methyltransferase EHMT2; HLA B associated transcript 8; HLA-B-associated transcript 8; KMT 1C; KMT1 C; Lysine N methyltransferase 1C; Lysine N-methyltransferase 1C; NG 36; NG36; Protein G9a
Target Background
This gene encodes a methyltransferase that methylates lysine residues of histone H3. Methylation of H3 at lysine 9 by this protein results in recruitment of additional epigenetic regulators and repression of transcription. This gene was initially thought to be two different genes, NG36 and G9a, adjacent to each other in the HLA locus. Alternative splicing results in multiple transcript variants.
Notification