-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human eIF2A (Q9BY44) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against eIF2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human eIF2A (Q9BY44) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16220A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF2A |
| Target Synonyms | CDA02; EIF-2A; MST089; MSTP004; MSTP089; eIF2A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Mouse liver, Rat lung | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human eIF2A (Q9BY44). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALRNKPITNSKLHEEEPPQNMKPQSGNDKPLSKTALKNQRKHEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNLKKKLKAIEQL | Uniprot ID | Q9BY44 |
Uniprot Id
Q9BY44
Target Species
Human
Target Name
EIF2A
Target Full Name
Eukaryotic translation initiation factor 2A
Target Function
Functions in the early steps of protein synthesis of a small number of specific mRNAs. Acts by directing the binding of methionyl-tRNAi to 40S ribosomal subunits. In contrast to the eIF-2 complex, it binds methionyl-tRNAi to 40S subunits in a codon-dependent manner, whereas the eIF-2 complex binds methionyl-tRNAi to 40S subunits in a GTP-dependent manner.
Target Protein Families
WD repeat EIF2A family
Target Tissue Specificity
Widely expressed. Expressed at higher level in pancreas, heart, brain and placenta.
Target Synonyms
65 kDa eukaryotic translation initiation factor 2A; CDA 02; CDA02; EIF 2; EIF 2A; eIF-2A; EIF2; eif2a; EIF2A_HUMAN; Eukaryotic translation initiation factor 2A 65kDa; Eukaryotic translation initiation factor 2A; MST089; MSTP004; MSTP089
Target Background
This gene encodes a eukaryotic translation initiation factor that catalyzes the formation of puromycin-sensitive 80 S preinitiation complexes and the poly(U)-directed synthesis of polyphenylalanine at low concentrations of Mg2+. This gene should not be confused with eIF2-alpha (EIF2S1, Gene ID: 1965), the alpha subunit of the eIF2 translation initiation complex. Although both of these proteins function in binding initiator tRNA to the 40 S ribosomal subunit, the encoded protein does so in a codon-dependent manner, whereas eIF2 complex requires GTP. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Notification