Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF4A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against eIF4A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-12522A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4A1 |
| Target Synonyms | DDX2A; EIF4A; EIF-4A; eIF4A-I; eIF-4A-I; eIF4A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, 293T, C2C12, HepG2, Mouse brain | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA | Uniprot ID | P60842 |
Uniprot Id
P60842
Target Species
Human
Target Name
EIF4A1
Target Full Name
Eukaryotic initiation factor 4A-I
Target Function
ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Target Protein Families
DEAD box helicase family, eIF4A subfamily
Target Research Area
Others
Target Synonyms
ATP-dependent RNA helicase eIF4A-1; DDX2; DDX2A; eIF 4A I ; eIF-4A-I; EIF4A; eIF4A I; eIF4A-I; EIF4A1; Eukaryotic initiation factor 4A-I; Eukaryotic initiation factor 4AI; eukaryotic translation initiation factor 4A, isoform 1; Eukaryotic translation initiation factor 4A1; IF4A1_HUMAN
Target Background
Enables double-stranded RNA binding activity. Predicted to be involved in cytoplasmic translational initiation. Located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
