-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF4G1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human EIF4G1 (NP_886553.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EIF4G1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human EIF4G1 (NP_886553.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10870A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4G1 |
| Target Synonyms | P220; EIF4F; EIF4G; EIF4GI; PARK18; EIF-4G1; EIF4G1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human EIF4G1 (NP_886553.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLR | Uniprot ID | Q04637 |
Uniprot Id
Q04637
Target Species
Human
Target Name
EIF4G1
Target Full Name
Eukaryotic translation initiation factor 4 gamma 1
Target Function
Component of the protein complex eIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure and recruitment of mRNA to the ribosome. As a member of the eIF4F complex, required for endoplasmic reticulum stress-induced ATF4 mRNA translation.
Target Involvement
Parkinson disease 18 (PARK18)
Target Subcellular Location
Cytoplasm, Stress granule.
Target Protein Families
Eukaryotic initiation factor 4G family
Target Research Area
Immunology, Epigenetics and Nuclear Signaling
Target Synonyms
DKFZp686A1451; eIF 4 gamma 1; eIF 4G 1; eIF 4G1; eIF-4-gamma 1; eIF-4G 1; eIF-4G1; EIF4 gamma; EIF4F; EIF4G; EIF4G1; EIF4GI; Eukaryotic translation initiation factor 4 gamma 1; IF4G1_HUMAN; p220
Target Background
The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage.
Notification