-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELOVL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 247-296 of human ELOVL2 (NP_060240.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ELOVL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 247-296 of human ELOVL2 (NP_060240.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07052A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELOVL2 |
| Target Synonyms | SSC2; ELOVL2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, MCF7, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 247-296 of human ELOVL2 (NP_060240.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ | Uniprot ID | Q9NXB9 |
Uniprot Id
Q9NXB9
Target Species
Human
Target Name
ELOVL2
Target Full Name
Very long chain fatty acid elongase 2
Target Function
Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA), acting specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA. May participate in the production of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
ELO family, ELOVL2 subfamily
Target Tissue Specificity
Liver and testis.
Target Synonyms
ELOVL2; ELG3; SSC2; Elongation of very long chain fatty acids protein 2; 3-keto acyl-CoA synthase ELOVL2; ELOVL fatty acid elongase 2; ELOVL FA elongase 2; Very long chain 3-ketoacyl-CoA synthase 2; Very long chain 3-oxoacyl-CoA synthase 2
Target Background
Enables fatty acid elongase activity. Involved in fatty acid elongation, polyunsaturated fatty acid and very long-chain fatty acid biosynthetic process. Located in endoplasmic reticulum.
Notification