Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELSPBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-223 of human ELSPBP1 (NP_071425.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ELSPBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-223 of human ELSPBP1 (NP_071425.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-04772A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELSPBP1 |
| Target Synonyms | E12; HE12; EL149; EDDM12; ELSPBP1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-223 of human ELSPBP1 (NP_071425.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNEGSKENLVWCATSYNYDQDHTWVYC | Uniprot ID | Q96BH3 |
Uniprot Id
Q96BH3
Target Species
Human
Target Name
ELSPBP1
Target Full Name
Epididymal sperm-binding protein 1
Target Function
Binds to spermatozoa upon ejaculation and may play a role in sperm capacitation. Has phosphorylcholine-binding activity.
Target Subcellular Location
Secreted.
Target Protein Families
Seminal plasma protein family
Target Tissue Specificity
Detected in cauda epididymidal fluid and on sperm membrane (at protein level).
Target Synonyms
E12; ELSPBP1; Epididymal secretory protein 12; Epididymal sperm-binding protein 1; ESPB1_HUMAN; hE12
Target Background
The protein encoded by this gene belongs to the sperm-coating protein family of epididymal origin. This protein and its canine homolog are the first known examples of proteins with four tandemly arranged fibronectin type 2 (Fn2) domains in the Fn2-module protein family.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
