-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EMC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 885-965 of human EMC1 (NP_055862.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EMC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 885-965 of human EMC1 (NP_055862.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-10363A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EMC1 |
| Target Synonyms | CAVIPMR; KIAA0090; EMC1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60, Jurkat, LO2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 885-965 of human EMC1 (NP_055862.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IPTEQSREENLIPYSPDVQIHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDDYDYVLI | Uniprot ID | Q8N766 |
Uniprot Id
Q8N766
Target Species
Human
Target Name
EMC1
Target Full Name
ER membrane protein complex subunit 1
Target Function
Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).
Target Involvement
Cerebellar atrophy, visual impairment, and psychomotor retardation (CAVIPMR)
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Target Protein Families
EMC1 family
Target Synonyms
2700016F22Rik; C230096C10Rik; Emc1; ER membrane protein complex subunit 1; Hypothetical protein LOC23065; K0090_HUMAN; KIAA0090; mKIAA0090; OTTHUMP00000215527; PSEC0263; RIKEN cDNA C230096C10 gene; RP1-43E13.1; RP23-371E13.1; Uncharacterized protein KIAA0090
Target Background
This gene encodes a single-pass type I transmembrane protein, which is a subunit of the endoplasmic reticulum membrane protein complex (EMC). Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification