Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EMX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human EMX1 (NP_004088.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EMX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human EMX1 (NP_004088.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from Mouse brain, using EMX1 Rabbit pAb at 1:800 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 60s.
| Cat.No | ADA-00331A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EMX1 |
| Target Synonyms | EMX1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 70-190 of human EMX1 (NP_004088.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFAR | Uniprot ID | Q04741 |
Uniprot Id
Q04741
Target Species
Human
Target Name
EMX1
Target Full Name
Homeobox protein EMX1
Target Function
Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Might be shuttling between the nucleus and the cytoplasm.
Target Protein Families
EMX homeobox family
Target Tissue Specificity
Cerebral cortex.
Target Synonyms
EMX1
Target Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in brain development; neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including nervous system development; neuroepithelial cell differentiation; and regulation of oligodendrocyte progenitor proliferation. Located in chromosome and nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
