Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENPP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-230 of human ENPP4 (NP_055751.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ENPP4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-230 of human ENPP4 (NP_055751.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03937A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENPP4 |
| Target Synonyms | NPP4; ENPP4 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | H460, Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-230 of human ENPP4 (NP_055751.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANSMYDAVTKKHFSDSNDKDPFWWNEAVPIWVTNQLQENRSSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENL | Uniprot ID | Q9Y6X5 |
Uniprot Id
Q9Y6X5
Target Species
Human
Target Name
ENPP4
Target Full Name
Bis(5'-adenosyl)-triphosphatase ENPP4
Target Function
Hydrolyzes extracellular Ap3A into AMP and ADP, and Ap4A into AMP and ATP. Ap3A and Ap4A are diadenosine polyphosphates thought to induce proliferation of vascular smooth muscle cells. Acts as a procoagulant, mediating platelet aggregation at the site of nascent thrombus via release of ADP from Ap3A and activation of ADP receptors.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Protein Families
Nucleotide pyrophosphatase/phosphodiesterase family
Target Tissue Specificity
Expressed on the surface of vascular endothelia.
Target Synonyms
NPP4; ENPP4
Target Background
Enables bis(5'-adenosyl)-triphosphatase activity. Involved in positive regulation of blood coagulation and purine ribonucleoside catabolic process. Located in extracellular exosome and membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
