Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ENPP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 378-477 of human ENPP5 (Q9UJA9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ENPP5 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 378-477 of human ENPP5 (Q9UJA9) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13206A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ENPP5 |
| Target Synonyms | NPP5; NPP-5; ENPP5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, SH-SY5Y, Y79 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 378-477 of human ENPP5 (Q9UJA9). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CHLLNITAMPHNGSFWNVQDLLNSAMPRVVPYTQSTILLPGSVKPAEYDQEGSYPYFIGVSLGSIIVIVFFVIFIKHLIHSQIPALQDMHAEIAQPLLQA | Uniprot ID | Q9UJA9 |
Uniprot Id
Q9UJA9
Target Species
Human
Target Name
ENPP5
Target Full Name
Ectonucleotide pyrophosphatase/phosphodiesterase family member 5
Target Function
Can hydrolyze NAD but cannot hydrolyze nucleotide di- and triphosphates. Lacks lysopholipase D activity. May play a role in neuronal cell communication.
Target Subcellular Location
Secreted. Membrane; Single-pass membrane protein.
Target Protein Families
Nucleotide pyrophosphatase/phosphodiesterase family
Target Synonyms
ENPP5; UNQ550/PRO1107; Ectonucleotide pyrophosphatase/phosphodiesterase family member 5; E-NPP 5; NPP-5
Target Background
This gene encodes a type-I transmembrane glycoprotein. Studies in rat suggest the encoded protein may play a role in neuronal cell communications. Alternatively spliced transcript variants have been described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
