-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPB41 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human EPB41(NP_001159477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against EPB41 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human EPB41(NP_001159477.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-04032A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPB41 |
| Target Synonyms | HE; EL1; 4.1R | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HEL, K-562 | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human EPB41(NP_001159477.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPSEWDKRLSTHSPFRTLNINGQIPTGEGPPLVKTQTVTISDNANAVKSEIPTKDVPIVHTETKTITYEAAQTDDNSGDLDPGVLLTAQTITSETPSSTTT | Uniprot ID | P11171 |
Uniprot Id
P11171
Target Species
Human
Target Name
EPB41
Target Full Name
Protein 4.1
Target Function
Protein 4.1 is a major structural element of the erythrocyte membrane skeleton. It plays a key role in regulating membrane physical properties of mechanical stability and deformability by stabilizing spectrin-actin interaction. Recruits DLG1 to membranes. Required for dynein-dynactin complex and NUMA1 recruitment at the mitotic cell cortex during anaphase.
Target Involvement
Elliptocytosis 1 (EL1)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Nucleus.
Target Synonyms
4.1R; 41_HUMAN; Band 4.1; E41P; EL 1; EL1; EL1 gene; Elliptocytosis 1; Elliptocytosis 1 RH linked; EPB 4.1; EPB 41; EPB4.1; Epb41; Erythrocyte membrane protein band 4.1 (elliptocytosis 1 RH linked); Erythrocyte membrane protein band 4.1; Erythrocyte surface protein band 4.1; HE; P4.1; Protein 4.1; Protein 4.1; red blood cell type
Target Background
The protein encoded by this gene, together with spectrin and actin, constitute the red cell membrane cytoskeletal network. This complex plays a critical role in erythrocyte shape and deformability. Mutations in this gene are associated with type 1 elliptocytosis (EL1). Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Notification