-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EPHX2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against EPHX2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13388A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EPHX2 |
| Target Synonyms | CEH; SEH; ABHD20; EPHX2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EPHX2 (P34913). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGATTRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARK | Uniprot ID | P34913 |
Uniprot Id
P34913
Target Species
Human
Target Name
EPHX2
Target Full Name
Bifunctional epoxide hydrolase 2
Target Function
Bifunctional enzyme. The C-terminal domain has epoxide hydrolase activity and acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides. Also determines steady-state levels of physiological mediators.; Bifunctional enzyme. The N-terminal domain has lipid phosphatase activity, with the highest activity towards threo-9,10-phosphonooxy-hydroxy-octadecanoic acid, followed by erythro-9,10-phosphonooxy-hydroxy-octadecanoic acid, 12-phosphonooxy-octadec-9Z-enoic acid and 12-phosphonooxy-octadec-9E-enoic acid. Has phosphatase activity toward lyso-glycerophospholipids with also some lower activity toward lysolipids of sphingolipid and isoprenoid phosphates.
Target Subcellular Location
Cytoplasm. Peroxisome.
Target Protein Families
AB hydrolase superfamily, Epoxide hydrolase family
Target Research Area
Cancer
Target Synonyms
Bifunctional epoxide hydrolase 2; CEH; Cytosolic epoxide hydrolase; EPHX2; Epoxide hydratase; Epoxide hydrolase 2; Epoxide hydrolase 2 cytoplasmic; epoxide hydrolase 2, cytosolic; Epoxide hydrolase soluble; HYES_HUMAN; SEH; Soluble epoxide hydrolase
Target Background
This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.
Notification