-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ERp57 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ERp57 (P30101) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ERp57 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ERp57 (P30101) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13860A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ERp57 |
| Target Synonyms | P58; ER60; ERp57; ERp60; ERp61; GRP57; GRP58; PI-PLC; HsT17083; HEL-S-269; HEL-S-93n | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Hep G2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ERp57 (P30101). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNG | Uniprot ID | P30101 |
Uniprot Id
P30101
Target Species
Human
Target Name
PDIA3
Target Full Name
Protein disulfide-isomerase A3
Target Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum lumen. Melanosome.
Target Protein Families
Protein disulfide isomerase family
Target Tissue Specificity
Detected in the flagellum and head region of spermatozoa (at protein level). Expressed in liver, stomach and colon (at protein level). Expressed in gastric parietal cells and chief cells (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
58 kDa glucose regulated protein; 58 kDa glucose-regulated protein; 58 kDa microsomal protein; Disulfide isomerase ER 60; Disulfide isomerase ER-60; Endoplasmic reticulum resident protein 57; Endoplasmic reticulum resident protein 60; ER p57; ER protein 57; ER protein 60; ERp 57; ERp57; ERp60; ERp61; Glucose Regulated Protein 58 Kd; GRP 57; GRP 58; GRP57; HsT17083; p58; PDIA 3; PDIA3; PDIA3_HUMAN; Phospholipase C alpha; PI PLC; Protein disulfide isomerase A3; Protein disulfide isomerase family A member 3; Protein disulfide-isomerase A3
Target Background
This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates. This protein also functions as a molecular chaperone that prevents the formation of protein aggregates.
Notification