-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ETV1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ETV1 (NP_004947.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ETV1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ETV1 (NP_004947.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02639A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ETV1 |
| Target Synonyms | ER81; ETV1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Rat kidney, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ETV1 (NP_004947.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPL | Uniprot ID | P50549 |
Uniprot Id
P50549
Target Species
Human
Target Name
ETV1
Target Full Name
ETS translocation variant 1
Target Function
Transcriptional activator that binds to DNA sequences containing the consensus pentanucleotide 5'-CGGA[AT]-3'.
Target Involvement
Ewing sarcoma (ES)
Target Subcellular Location
Nucleus.
Target Protein Families
ETS family
Target Tissue Specificity
Very highly expressed in brain, highly expressed in testis, lung and heart, moderately in spleen, small intestine, pancreas and colon, weakly in liver, prostate and thymus, very weakly in skeletal muscle, kidney and ovary and not in placenta and periphera
Target Synonyms
DKFZp781L0674; ER81; ER81 protein; ER81; mouse; homolog of; ETS translocation variant 1; ets variant gene 1; Ets-related protein 81; Etsrp81; ETV 1; ETV1; ETV1_HUMAN; MGC104699; MGC120533; MGC120534
Target Background
This gene encodes a member of the ETS (E twenty-six) family of transcription factors. The ETS proteins regulate many target genes that modulate biological processes like cell growth, angiogenesis, migration, proliferation and differentiation. All ETS proteins contain an ETS DNA-binding domain that binds to DNA sequences containing the consensus 5'-CGGA[AT]-3'. The protein encoded by this gene contains a conserved short acidic transactivation domain (TAD) in the N-terminal region, in addition to the ETS DNA-binding domain in the C-terminal region. This gene is involved in chromosomal translocations, which result in multiple fusion proteins including EWS-ETV1 in Ewing sarcoma and at least 10 ETV1 partners (see PMID: 19657377, Table 1) in prostate cancer. In addition to chromosomal rearrangement, this gene is overexpressed in prostate cancer, melanoma and gastrointestinal stromal tumor. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Notification