Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAIM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human FAIM2 (NP_036438.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAIM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human FAIM2 (NP_036438.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03150A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAIM2 |
| Target Synonyms | LFG; LFG2; NGP35; NMP35; TMBIM2; FAIM2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human FAIM2 (NP_036438.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRK | Uniprot ID | Q9BWQ8 |
Uniprot Id
Q9BWQ8
Target Species
Human
Target Name
FAIM2
Target Full Name
Protein lifeguard 2
Target Function
Antiapoptotic protein which protects cells uniquely from Fas-induced apoptosis. Regulates Fas-mediated apoptosis in neurons by interfering with caspase-8 activation. May play a role in cerebellar development by affecting cerebellar size, internal granular layer (IGL) thickness, and Purkinje cell (PC) development.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Membrane raft. Cell junction, synapse, postsynaptic cell membrane.
Target Protein Families
BI1 family, LFG subfamily
Target Tissue Specificity
Highly expressed in breast carcinoma tissues. Enhanced expression correlates with the grade of the tumor (grade II/grade III) in primary breast tumors (at protein level). Widely expressed. Expressed at high levels in the brain especially in the hippocampu
Target Synonyms
FAIM2; KIAA0950; LFG; LFG2; NMP35; TMBIM2; Protein lifeguard 2; Fas apoptotic inhibitory molecule 2; Neural membrane protein 35; Transmembrane BAX inhibitor motif-containing protein 2
Target Background
Involved in regulation of neuron apoptotic process. Acts upstream of or within negative regulation of extrinsic apoptotic signaling pathway via death domain receptors. Located in membrane raft.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
