-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAM107A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human FAM107A (NP_009108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAM107A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human FAM107A (NP_009108.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00249A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAM107A |
| Target Synonyms | DRR1; TU3A; FAM107A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-144 of human FAM107A (NP_009108.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL | Uniprot ID | O95990 |
Uniprot Id
O95990
Target Species
Human
Target Name
FAM107A
Target Full Name
Actin-associated protein FAM107A
Target Function
Stress-inducible actin-binding protein that plays a role in synaptic and cognitive functions by modulating actin filamentous (F-actin) dynamics. Mediates polymerization of globular actin to F-actin. Also binds to, stabilizes and bundles F-actin. Involved in synaptic function by regulating neurite outgrowth in an actin-dependent manner and for the acquisition of hippocampus-dependent cognitive function, such as learning and long-term memory. Plays a role in the actin and microtubule cytoskeleton organization; negatively regulates focal adhesion (FA) assembly promoting malignant glial cell migration in an actin-, microtubule- and MAP1A-dependent manner. Also involved in neuroblastoma G1/S phase cell cycle progression and cell proliferation inhibition by stimulating ubiquitination of NF-kappa-B subunit RELA and NF-kappa-B degradation in a COMMD1- and actin-dependent manner. May play a role in tumor development.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, stress fiber. Cell junction, focal adhesion. Cell projection, ruffle membrane. Cell junction, synapse.
Target Protein Families
FAM107 family
Target Tissue Specificity
Widely expressed. Expressed in neurons. Expressed in malignant glial tumors. Expression is reduced or absent in a number of cancer cell lines.
Target Synonyms
Down regulated in renal cell carcinoma 1; Down-regulated in renal cell carcinoma 1; Downregulated in renal cell carcinoma; DRR1; F107A_HUMAN; FAM107A; Family with sequence similarity 107; member A ; FLJ30158 ; FLJ45473; Protein FAM107A; Protein TU3A; TU3A
Target Background
Predicted to enable actin binding activity. Involved in several processes, including negative regulation of G1/S transition of mitotic cell cycle; negative regulation of focal adhesion assembly; and regulation of cytoskeleton organization. Located in several cellular components, including focal adhesion; ruffle membrane; and stress fiber.
Notification