Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAM117B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 293-372 of human FAM117B (NP_775782.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAM117B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 293-372 of human FAM117B (NP_775782.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09798A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAM117B |
| Target Synonyms | ALS2CR13; FAM117B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 293-372 of human FAM117B (NP_775782.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLNQEIEIIIKETGEKEEQLIPQDI | Uniprot ID | Q6P1L5 |
Uniprot Id
Q6P1L5
Target Species
Human
Target Name
FAM117B
Target Full Name
Protein FAM117B
Target Synonyms
amyotrophic lateral sclerosis 2 (juvenile) chromosome region; candidate 13; Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 13 protein; F117B_HUMAN; Fam117b; Family with sequence similarity 117 member B; Protein FAM117B
Target Background
FAM117B (Family With Sequence Similarity 117 Member B) is a Protein Coding gene. Diseases associated with FAM117B include Lateral Sclerosis and Amyotrophic Lateral Sclerosis 2, Juvenile. An important paralog of this gene is GLCCI1.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
