-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FAM120A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FAM120A (NP_055427.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FAM120A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FAM120A (NP_055427.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07001A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FAM120A |
| Target Synonyms | OSSA; C9orf10; HBVPTPAP; FAM120A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FAM120A (NP_055427.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQWNHMLGYLAALAKACFGGNIELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLP | Uniprot ID | Q9NZB2 |
Uniprot Id
Q9NZB2
Target Species
Human
Target Name
FAM120A
Target Full Name
Constitutive coactivator of PPAR-gamma-like protein 1
Target Function
May participate in mRNA transport in the cytoplasm. Critical component of the oxidative stress-induced survival signaling. Activates src family kinases and acts as a scaffolding protein enabling src family kinases to phosphorylate and activate PI3-kinase. Binds RNA and promotes the secretion of IGF-II. May play a pivotal role in the progression of scirrhous-type gastric cancer by supporting cancer cell survival in environments with various oxidative stresses.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note=Translocates to plasma membrane upon ultraviolet exposure.
Target Protein Families
Constitutive coactivator of PPAR-gamma family
Target Tissue Specificity
Ubiquitously expressed. Highly expressed in scirrhous-type gastric cancer tissues compared with normal gastric mucosa (at protein level).
Target Synonyms
C9orf10; Chromosome 9 open reading frame 10; Constitutive coactivator of PPAR gamma like protein 1; Constitutive coactivator of PPAR-gamma-like protein 1; DNA polymerase transactivated protein 5; DNA polymerase transactivated protein 1; DNAPTP1; DNAPTP5; F120A_HUMAN; FAM120A; Family with sequence similarity 120A; Hypothetical protein LOC23196; KIAA0183; LOC23196; MGC111527; MGC133257; OSSA; Oxidative stress-associated Src activator; Protein FAM120A
Target Background
Enables RNA binding activity. Located in cytosol.
Notification